PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00007142-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 93aa    MW: 10863.6 Da    PI: 8.9542
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00007142-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.2e-181461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++l+ +++++G g+W++ ++  g+ R++k+c++rw +yl
  WALNUT_00007142-RA 14 KGPWTPEEDQILITYIQLYGHGNWRALPKQAGLLRCGKSCRLRWTNYL 61
                        79******************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-27564IPR009057Homeodomain-like
PROSITE profilePS5129424.287965IPR017930Myb domain
SMARTSM007173.4E-151363IPR001005SANT/Myb domain
PfamPF002491.9E-171461IPR001005SANT/Myb domain
SuperFamilySSF466891.24E-251592IPR009057Homeodomain-like
CDDcd001672.89E-121661No hitNo description
PROSITE profilePS500904.4496293IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.4E-96588IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MVRAPCCEKM GLKKGPWTPE EDQILITYIQ LYGHGNWRAL PKQAGLLRCG KSCRLRWTNY  60
LRPDIKRGNF SREEEDAIIN LHEMLGNRSV YID
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-17129225104MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007050304.12e-58Myb domain protein 13, putative
RefseqXP_006479545.12e-58PREDICTED: myb-related protein Myb4
RefseqXP_006443843.12e-58hypothetical protein CICLE_v10021699mg
SwissprotQ7XBH48e-55MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A061DQS72e-58A0A061DQS7_THECC; Myb domain protein 13, putative
TrEMBLV4T9U32e-58V4T9U3_9R
STRINGPOPTR_0005s24550.11e-55(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.15e-56myb domain protein 15